General Information


DRAVP ID  DRAVPe00256

Peptide Name   2410

Sequence  MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL

Sequence Length  38

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV

Assay  MAGI/cMAGI infectivity assay

Activity 

  • [Ref.17640899]HIV IIIB:inhibition of virus infection on CEM4 cells(IC50=0.008 μg/ml);
  • HIV 098:inhibition of virus infection on CEM4 cells(IC50=0.032μg/ml);
  • HIV 098-T20:inhibition of virus infection on CEM4 cells(IC50=0.039 μg/ml);
  • HIV 098-T1249:inhibition of virus infection on CEM4 cells(IC50=0.137 μg/ml);
  • HIV 098-T651:inhibition of virus infection on CEM4 cells(IC50=4.975 μg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  membrane

Mechanism  The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00256

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C204H314N54O71S2

Absent amino acids  ACFGPV

Common amino acids  E

Mass  4723.18

Pl  4.14

Basic residues  3

Acidic residues  9

Hydrophobic residues  10

Net charge  -6

Boman Index  -10381

Hydrophobicity  -109.74

Aliphatic Index  82.11

Half Life 

  •     Mammalian:30 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  12490

Absorbance 280nm  337.57

Polar residues  10



Literature Information


Literature 1

Title   Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Pubmed ID   17640899

Reference   Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7. 

Author   Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK.

DOI   10.1073/pnas.0701478104