General Information
DRAVP ID DRAVPe00256
Peptide Name 2410
Sequence MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL
Sequence Length 38
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay MAGI/cMAGI infectivity assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00256
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C204H314N54O71S2
Absent amino acids ACFGPV
Common amino acids E
Mass 4723.18
Pl 4.14
Basic residues 3
Acidic residues 9
Hydrophobic residues 10
Net charge -6
Boman Index -10381
Hydrophobicity -109.74
Aliphatic Index 82.11
Half Life
Extinction Coefficient cystines 12490
Absorbance 280nm 337.57
Polar residues 10
Literature Information
Literature 1
Title Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.
Pubmed ID 17640899
Reference Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7.
Author Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK.