General Information

General Information

DRAVP ID DRAVPe00256

Peptide Name 2410

Sequence MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL

Sequence Length 38

UniProt ID No entry found

Source Synthetic construct

Activity Information

Target Organism HIV

Assay MAGI/cMAGI infectivity assay

Activity

[Ref.17640899]HIV IIIB:inhibition of virus infection on CEM4 cells(IC50=0.008 μg/ml);
HIV 098:inhibition of virus infection on CEM4 cells(IC50=0.032μg/ml);
HIV 098-T20:inhibition of virus infection on CEM4 cells(IC50=0.039 μg/ml);
HIV 098-T1249:inhibition of virus infection on CEM4 cells(IC50=0.137 μg/ml);
HIV 098-T651:inhibition of virus infection on CEM4 cells(IC50=4.975 μg/ml).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target membrane

Mechanism The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00256

Linear/Cyclic Linear

N-terminal Modification Acetylation

C-terminal Modification Amidation

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C204H314N54O71S2

Absent amino acids ACFGPV

Common amino acids E

Mass 4723.18

Pl 4.14

Basic residues 3

Acidic residues 9

Hydrophobic residues 10

Net charge -6

Boman Index -10381

Hydrophobicity -109.74

Aliphatic Index 82.11

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 12490

Absorbance 280nm 337.57

Polar residues 10

Literature Information

Literature 1

Title Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Pubmed ID 17640899

Reference Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7.

Author Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK.

DOI 10.1073/pnas.0701478104