General Information

General Information

DRAVP ID DRAVPe00278

Peptide Name Circulin-A (CIRA; Plant defensin)

Sequence GIPCGESCVWIPCISAALGCSCKNKVCYRN

Sequence Length 30

UniProt ID P56871

Source Chassalia parviflora

Activity Information

Target Organism HIV

Assay

Activity

[Ref.18008336]HIV-1:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=40-260 nM).

Hemolytic Activity

[Ref.10430870] EC50 = 1020 μM against blood type A human erythrocytes.

Cytotoxicity

[Ref.18008336]CEM-SS cells:IC50=500 nM.

Binding Target Not found

Mechanism No machanism information found in the reference(s) presented in this entry

Structure Information

PDB ID 1BH4

Predicted Structure Download DRAVPe00278

Linear/Cyclic Cyclic

N-terminal Modification Cyclization (N termini to C termini)

C-terminal Modification Cyclization (C termini to N termini)

Other Modification Disulfide bonds between Cys4 and Cys20, Cys8 and Cys22, Cys13 and Cys27.

Stereochemistry L

Physicochemical Information

Formula C134H216N38O39S6

Absent amino acids DFHMQT

Common amino acids C

Mass 3175.78

Pl 8.33

Basic residues 3

Acidic residues 1

Hydrophobic residues 9

Net charge 2

Boman Index -1224

Hydrophobicity 41.67

Aliphatic Index 78

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 7365

Absorbance 280nm 253.97

Polar residues 15

Literature Information

Literature 1

Title Cyclotides as natural anti-HIV agents.

Pubmed ID 18008336

Reference Biopolymers. 2008;90(1):51-60.

Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI 10.1002/bip.20886

Literature 2

Title An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides.

Pubmed ID 10430870

Reference Proc Natl Acad Sci U S A. 1999 Aug 3;96(16):8913-8.

Author Tam JP, Lu YA, Yang JL, Chiu KW.

DOI 10.1073/pnas.96.16.8913