General Information


DRAVP ID  DRAVPe00278

Peptide Name   Circulin-A (CIRA; Plant defensin)

Sequence  GIPCGESCVWIPCISAALGCSCKNKVCYRN

Sequence Length  30

UniProt ID  P56871 

Taxon ID  None

Source  Chassalia parviflora

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV

Assay 

Activity 

  • [Ref.18008336]HIV-1:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=40-260 nM).

Hemolytic Activity 

  • [Ref.10430870] EC50 = 1020 μM against blood type A human erythrocytes.

Cytotoxicity 

  • [Ref.18008336]CEM-SS cells:IC50=500 nM.

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  1BH4 

Predicted Structure Download  DRAVPe00278

Linear/Cyclic  Cyclic

N-terminal Modification  Cyclization (N termini to C termini)

C-terminal Modification  Cyclization (C termini to N termini)

Other Modification  Disulfide bonds between Cys4 and Cys20, Cys8 and Cys22, Cys13 and Cys27.

Stereochemistry  L



Physicochemical Information


Formula  C134H216N38O39S6

Absent amino acids  DFHMQT

Common amino acids  C

Mass  3175.78

Pl  8.33

Basic residues  3

Acidic residues  1

Hydrophobic residues  9

Net charge  2

Boman Index  -1224

Hydrophobicity  41.67

Aliphatic Index  78

Half Life 

  •     Mammalian:30 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  7365

Absorbance 280nm  253.97

Polar residues  15



Literature Information


Literature 1

Title   Cyclotides as natural anti-HIV agents.

Pubmed ID   18008336

Reference   Biopolymers. 2008;90(1):51-60.

Author   Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI   10.1002/bip.20886

Literature 2

Title   An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides.

Pubmed ID   10430870

Reference   Proc Natl Acad Sci U S A. 1999 Aug 3;96(16):8913-8.

Author   Tam JP, Lu YA, Yang JL, Chiu KW.

DOI   10.1073/pnas.96.16.8913