General Information
DRAVP ID DRAVPe00278
Peptide Name Circulin-A (CIRA; Plant defensin)
Sequence GIPCGESCVWIPCISAALGCSCKNKVCYRN
Sequence Length 30
UniProt ID P56871
Taxon ID None
Source Chassalia parviflora
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay
Activity
Hemolytic Activity
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID 1BH4
Predicted Structure Download DRAVPe00278
Linear/Cyclic Cyclic
N-terminal Modification Cyclization (N termini to C termini)
C-terminal Modification Cyclization (C termini to N termini)
Other Modification Disulfide bonds between Cys4 and Cys20, Cys8 and Cys22, Cys13 and Cys27.
Stereochemistry L
Physicochemical Information
Formula C134H216N38O39S6
Absent amino acids DFHMQT
Common amino acids C
Mass 3175.78
Pl 8.33
Basic residues 3
Acidic residues 1
Hydrophobic residues 9
Net charge 2
Boman Index -1224
Hydrophobicity 41.67
Aliphatic Index 78
Half Life
Extinction Coefficient cystines 7365
Absorbance 280nm 253.97
Polar residues 15
Literature Information
Literature 1
Title Cyclotides as natural anti-HIV agents.
Pubmed ID 18008336
Reference Biopolymers. 2008;90(1):51-60.
Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.
Literature 2
Title An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides.
Pubmed ID 10430870
Reference Proc Natl Acad Sci U S A. 1999 Aug 3;96(16):8913-8.
Author Tam JP, Lu YA, Yang JL, Chiu KW.