General Information

General Information

DRAVP ID DRAVPe00279

Peptide Name Circulin-B (CIRB; Plant defensin)

Sequence GVIPCGESCVFIPCISTLLGCSCKNKVCYRN

Sequence Length 31

UniProt ID P56879

Taxon ID None

Source Chassalia parviflora

Validation Experimentally Validated

Origin Information

Gene Name/ID Not Available

GenBank Not Available

Amino Acid position Not Available

Domain Accession ID Not Available

Nucleotide sequence ID Not Available

Molecular Type Not Available

Chromosomal Position Not Available

Activity Information

Target Organism HIV

Assay

Activity

[Ref.18008336]HIV-1:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=40-260 nM).

Hemolytic Activity

[Ref.10430870] EC50 = 550 μM against blood type A human erythrocytes.

Cytotoxicity

[Ref.10430870] It caused 50% cell growth inhibition of mouse fibroblasts at 820 μM.
[Ref.18008336]CEM-SS cells:IC50=500 nM.

Binding Target Not found

Mechanism No machanism information found in the reference(s) presented in this entry

Structure Information

PDB ID 2ERI

Predicted Structure Download DRAVPe00279

Linear/Cyclic Cyclic

N-terminal Modification Cyclization (N termini to C termini)

C-terminal Modification Cyclization (C termini to N termini)

Other Modification Disulfide bonds between Cys5 and Cys19, Cys9 and Cys21, Cys14 and Cys27.

Stereochemistry L

Physicochemical Information

Formula C141H232N38O41S6

Absent amino acids ADHMQW

Common amino acids C

Mass 3307.98

Pl 8.33

Basic residues 3

Acidic residues 1

Hydrophobic residues 9

Net charge 2

Boman Index -882

Hydrophobicity 64.19

Aliphatic Index 90.97

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 1865

Absorbance 280nm 62.17

Polar residues 16

Literature Information

Literature 1

Title Cyclotides as natural anti-HIV agents.

Pubmed ID 18008336

Reference Biopolymers. 2008;90(1):51-60.

Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI 10.1002/bip.20886

Literature 2

Title An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides.

Pubmed ID 10430870

Reference Proc Natl Acad Sci U S A. 1999 Aug 3;96(16):8913-8.

Author Tam JP, Lu YA, Yang JL, Chiu KW.

DOI 10.1073/pnas.96.16.8913