DRAVP ID  DRAVPe00280

Peptide Name   Circulin-C (CIRC; Plant defensin)

Sequence  GIPCGESCVFIPCITSVAGCSCKSKVCYRN

Sequence Length  30

UniProt ID  P84641 

Source  Chassalia parviflora

Target Organism  HIV

Assay 

Activity 

• [Ref.18008336]HIV-1:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=50-275 nM).
• [Ref.10691702]HIV-1(HIV-1 IIIB):inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=73 nM);
• HIV-1(HIV-1 RF):inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=165 nM);
• HIV-1(HIV-1 214):inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=213 nM);
• HIV-1(HIV-1 205):inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=155 nM);
• HIV-1(HIV-1 G):inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=111 nM);
• HIV-1(HIV-1 SK1):inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=51 nM);
• HIV-1(HIV-1 N119):inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=241 nM);
• HIV-1(HIV-1 A17):inhibition the cytopathic effects of HIV-1 infection in MT-2 cells(EC50=247 nM);
• HIV-1(HIV-1G9106):inhibition the cytopathic effects of HIV-1 infection in MT-2 cells(EC50=67 nM);
• HIV-1(HIV-1 H1122):inhibition the cytopathic effects of HIV-1 infection in MT-2 cells(EC50=48 nM);
• HIV-1(HIV-1 IIIB):inhibition the cytopathic effects of HIV-1 infection in MT-2 cells(EC50=200 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry

PDB ID  None

Predicted Structure Download  DRAVPe00280

Linear/Cyclic  Cyclic

N-terminal Modification  Cyclization (N termini to C termini)

C-terminal Modification  Cyclization (N termini to C termini)

Other Modification  Disulfide bonds between Cys4 and Cys20, Cys8 and Cys22,Cys13 and Cys27.

Stereochemistry  L

Literature 1

Title   Cyclotides as natural anti-HIV agents.

Pubmed ID   18008336

Reference   Biopolymers. 2008;90(1):51-60.

Author   Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI   10.1002/bip.20886

Literature 2

Title   New circulin macrocyclic polypeptides from Chassalia parvifolia.

Pubmed ID   10691702

Reference   J Nat Prod. 2000 Feb;63(2):176-8.

Author   Gustafson KR, Walton LK, Sowder RC Jr, Johnson DG, Pannell LK, Cardellina JH Jr, Boyd MR.

DOI   10.1021/np990432r