To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00281
Peptide Name Circulin-D (CIRD; Plant defensin)
Sequence KIPCGESCVWIPCVTSIFNCKCENKVCYHD
Sequence Length 30
UniProt ID P84642
Source Chassalia parviflora
Activity Information
Target Organism HIV
Assay XTT [2,3-bis-(2-methoxy-4-nitro-5-sulphophenyl)-2H-tetrazolium-5-carboxanilide]
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00281
Linear/Cyclic Cyclic
N-terminal Modification Cyclization (N termini to C termini)
C-terminal Modification Cyclization (N termini to C termini)
Other Modification Disulfide bonds between Cys4 and Cys20, Cys8 and Cys22,Cys13 and Cys27.
Stereochemistry L
Physicochemical Information
Formula C148H228N38O43S6
Absent amino acids ALMQR
Common amino acids C
Mass 3420.03
Pl 6.71
Basic residues 4
Acidic residues 3
Hydrophobic residues 8
Net charge 1
Boman Index -2563
Hydrophobicity 11.33
Aliphatic Index 68
Half Life
Extinction Coefficient cystines 7365
Absorbance 280nm 253.97
Polar residues 13
Literature Information
Literature 1
Title Cyclotides as natural anti-HIV agents.
Pubmed ID 18008336
Reference Biopolymers. 2008;90(1):51-60.
Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.