General Information


DRAVP ID  DRAVPe00282

Peptide Name   Circulin-E (CIRE; Plant defensin)

Sequence  KIPCGESCVWIPCLTSVFNCKCENKVCYHD

Sequence Length  30

UniProt ID  P84643 

Taxon ID  None

Source  Chassalia parviflora

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not available



Activity Information


Target Organism  HIV

Assay 

Activity 

  • [Ref.18008336]HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=50-275 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00282

Linear/Cyclic  Cyclic

N-terminal Modification  Cyclization (N termini to C termini)

C-terminal Modification  Cyclization (N termini to C termini)

Other Modification  Disulfide bonds between Cys4 and Cys20, Cys8 and Cys22,Cys13 and Cys27.

Stereochemistry  L



Physicochemical Information


Formula  C148H228N38O43S6

Absent amino acids  AMQR

Common amino acids  C

Mass  3420.03

Pl  6.71

Basic residues  4

Acidic residues  3

Hydrophobic residues  8

Net charge  1

Boman Index  -2563

Hydrophobicity  9

Aliphatic Index  68

Half Life 

  •     Mammalian:1.3 hour
  •     Yeast:3 min
  •     E.coli:2 min

Extinction Coefficient cystines  7365

Absorbance 280nm  253.97

Polar residues  13



Literature Information


Literature 1

Title   Cyclotides as natural anti-HIV agents.

Pubmed ID   18008336

Reference   Biopolymers. 2008;90(1):51-60.

Author   Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI   10.1002/bip.20886