To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00284
Peptide Name Cycloviolin-A (Plant defensin)
Sequence GVIPCGESCVFIPCISAAIGCSCKNKVCYRN
Sequence Length 31
UniProt ID P84637
Source Leonia cymosa (Sacha uba)
Activity Information
Target Organism HIV
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00284
Linear/Cyclic Cyclic
N-terminal Modification Cyclization (N termini to C termini)
C-terminal Modification Cyclization (N termini to C termini)
Other Modification Disulfide bonds between Cys5 and Cys21, Cys9 and Cys23,Cys14 and Cys28.
Stereochemistry L
Physicochemical Information
Formula C137H224N38O40S6
Absent amino acids DHLMQTW
Common amino acids C
Mass 3235.88
Pl 8.33
Basic residues 3
Acidic residues 1
Hydrophobic residues 10
Net charge 2
Boman Index -755
Hydrophobicity 68.06
Aliphatic Index 84.84
Half Life
Extinction Coefficient cystines 1865
Absorbance 280nm 62.17
Polar residues 15
Literature Information
Literature 1
Title Cyclotides as natural anti-HIV agents.
Pubmed ID 18008336
Reference Biopolymers. 2008;90(1):51-60.
Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.