To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00287
Peptide Name Cycloviolin-D (Plant defensin)
Sequence GFPCGESCVFIPCISAAIGCSCKNKVCYRN
Sequence Length 30
UniProt ID P84640
Source Leonia cymosa (Sacha uba)
Activity Information
Target Organism HIV
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00287
Linear/Cyclic Cyclic
N-terminal Modification Cyclization (N termini to C termini)
C-terminal Modification Cyclization (N termini to C termini)
Other Modification Disulfide bonds between Cys4 and Cys20, Cys8 and Cys22,Cys13 and Cys27.
Stereochemistry L
Physicochemical Information
Formula C135H213N37O39S6
Absent amino acids DHLMQTW
Common amino acids C
Mass 3170.76
Pl 8.33
Basic residues 3
Acidic residues 1
Hydrophobic residues 9
Net charge 2
Boman Index -1353
Hydrophobicity 50.67
Aliphatic Index 65
Half Life
Extinction Coefficient cystines 1865
Absorbance 280nm 64.31
Polar residues 15
Literature Information
Literature 1
Title Cyclotides as natural anti-HIV agents.
Pubmed ID 18008336
Reference Biopolymers. 2008;90(1):51-60.
Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.