General Information

General Information

DRAVP ID DRAVPe00288

Peptide Name Cycloviolacin-O13 (Cyclotide c3; Plant defensin)

Sequence GIPCGESCVWIPCISAAIGCSCKSKVCYRN

Sequence Length 30

UniProt ID Q5USN8

Source Viola odorata (Sweet violet)

Activity Information

Target Organism HIV

Assay

Activity

[Ref.18008336]HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=320 nM).

Hemolytic Activity

[Ref.16872274] It has 50% hemolytic activity at 1.0 μM and 75% hemolytic activity at 1.5 μM against human type A red blood cells

Cytotoxicity

[Ref.18008336]CEM-SS cells:IC50=6400 nM.

Binding Target Not found

Mechanism No machanism information found in the reference(s) presented in this entry

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00288

Linear/Cyclic Cyclic

N-terminal Modification Cyclization (N termini to C termini)

C-terminal Modification Cyclization (N termini to C termini)

Other Modification Disulfide bonds between Cys4 and Cys20; Cys8 and Cys22; Cys13 and Cys27.

Stereochemistry L

Physicochemical Information

Formula C133H215N37O39S6

Absent amino acids DFHLMQT

Common amino acids C

Mass 3148.75

Pl 8.33

Basic residues 3

Acidic residues 1

Hydrophobic residues 9

Net charge 2

Boman Index -900

Hydrophobicity 53

Aliphatic Index 78

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 7365

Absorbance 280nm 253.97

Polar residues 15

Literature Information

Literature 1

Title Cyclotides as natural anti-HIV agents.

Pubmed ID 18008336

Reference Biopolymers. 2008;90(1):51-60.

Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI 10.1002/bip.20886

Literature 2

Title A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.

Pubmed ID 16872274

Reference Biochem J. 2006 Nov 15;400(1):1-12.

Author Ireland DC, Colgrave ML, Craik DJ.

DOI 10.1042/BJ20060627