General Information

General Information

DRAVP ID DRAVPe00288

Peptide Name Cycloviolacin-O13 (Cyclotide c3; Plant defensin)

Sequence GIPCGESCVWIPCISAAIGCSCKSKVCYRN

Sequence Length 30

UniProt ID Q5USN8

Taxon ID None

Source Viola odorata (Sweet violet)

Validation Experimentally Validated

Origin Information

Gene Name/ID Not Available

GenBank Not Available

Amino Acid position Not Available

Domain Accession ID Not Available

Nucleotide sequence ID Not Available

Molecular Type Not Available

Chromosomal Position Not available

Activity Information

Target Organism HIV

Assay

Activity

[Ref.18008336]HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=320 nM).

Hemolytic Activity

[Ref.16872274] It has 50% hemolytic activity at 1.0 μM and 75% hemolytic activity at 1.5 μM against human type A red blood cells

Cytotoxicity

[Ref.18008336]CEM-SS cells:IC50=6400 nM.

Binding Target Not found

Mechanism No machanism information found in the reference(s) presented in this entry

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00288

Linear/Cyclic Cyclic

N-terminal Modification Cyclization (N termini to C termini)

C-terminal Modification Cyclization (N termini to C termini)

Other Modification Disulfide bonds between Cys4 and Cys20; Cys8 and Cys22; Cys13 and Cys27.

Stereochemistry L

Physicochemical Information

Formula C133H215N37O39S6

Absent amino acids DFHLMQT

Common amino acids C

Mass 3148.75

Pl 8.33

Basic residues 3

Acidic residues 1

Hydrophobic residues 9

Net charge 2

Boman Index -900

Hydrophobicity 53

Aliphatic Index 78

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 7365

Absorbance 280nm 253.97

Polar residues 15

Literature Information

Literature 1

Title Cyclotides as natural anti-HIV agents.

Pubmed ID 18008336

Reference Biopolymers. 2008;90(1):51-60.

Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI 10.1002/bip.20886

Literature 2

Title A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.

Pubmed ID 16872274

Reference Biochem J. 2006 Nov 15;400(1):1-12.

Author Ireland DC, Colgrave ML, Craik DJ.

DOI 10.1042/BJ20060627