General Information
DRAVP ID DRAVPe00288
Peptide Name Cycloviolacin-O13 (Cyclotide c3; Plant defensin)
Sequence GIPCGESCVWIPCISAAIGCSCKSKVCYRN
Sequence Length 30
UniProt ID Q5USN8
Taxon ID None
Source Viola odorata (Sweet violet)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism HIV
Assay
Activity
Hemolytic Activity
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00288
Linear/Cyclic Cyclic
N-terminal Modification Cyclization (N termini to C termini)
C-terminal Modification Cyclization (N termini to C termini)
Other Modification Disulfide bonds between Cys4 and Cys20; Cys8 and Cys22; Cys13 and Cys27.
Stereochemistry L
Physicochemical Information
Formula C133H215N37O39S6
Absent amino acids DFHLMQT
Common amino acids C
Mass 3148.75
Pl 8.33
Basic residues 3
Acidic residues 1
Hydrophobic residues 9
Net charge 2
Boman Index -900
Hydrophobicity 53
Aliphatic Index 78
Half Life
Extinction Coefficient cystines 7365
Absorbance 280nm 253.97
Polar residues 15
Literature Information
Literature 1
Title Cyclotides as natural anti-HIV agents.
Pubmed ID 18008336
Reference Biopolymers. 2008;90(1):51-60.
Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.
Literature 2
Title A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.
Pubmed ID 16872274
Reference Biochem J. 2006 Nov 15;400(1):1-12.
Author Ireland DC, Colgrave ML, Craik DJ.