General Information

General Information

DRAVP ID DRAVPe00294

Peptide Name Cycloviolacin-Y5 (Plants)

Sequence GIPCAESCVWIPCTVTALVGCSCSDKVCYN

Sequence Length 30

UniProt ID No entry found

Source Viola yedoensis (Chinese herb)

Activity Information

Target Organism HIV

Assay

Activity

[Ref.18618891]Effects: H. contortus( IC50=2.28μM, IC99=22.24μM) and T. colubriformis(IC50=2.40μM, IC99=10.97μM).
[Ref.18008336]HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=40 nM).

Hemolytic Activity

[Ref:18081258] HD50=8.7 μM against human type A red blood cells.

Cytotoxicity

[Ref.18008336]CEM-SS cells:IC50=1760 nM.

Binding Target Not found

Mechanism No machanism information found in the reference(s) presented in this entry

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00294

Linear/Cyclic Cyclic

N-terminal Modification Cyclization (N termini to C termini)

C-terminal Modification Cyclization (N termini to C termini)

Other Modification Disulfide bonds between Cys4 and Cys21; Cys8 and Cys23; Cys13 and Cys28.

Stereochemistry L

Physicochemical Information

Formula C132H209N33O42S6

Absent amino acids FHMQR

Common amino acids C

Mass 3122.67

Pl 4.37

Basic residues 1

Acidic residues 2

Hydrophobic residues 10

Net charge -1

Boman Index 323

Hydrophobicity 79.33

Aliphatic Index 84.33

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 7365

Absorbance 280nm 253.97

Polar residues 15

Literature Information

Literature 1

Title Cyclotides as natural anti-HIV agents.

Pubmed ID 18008336

Reference Biopolymers. 2008;90(1):51-60.

Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI 10.1002/bip.20886

Literature 2

Title Anti-HIV cyclotides from the Chinese medicinal herb Viola yedoensis.

Pubmed ID 18081258

Reference J Nat Prod. 2008 Jan;71(1):47-52.

Author Wang CK, Colgrave ML, Gustafson KR, Ireland DC, Goransson U, Craik DJ.

DOI 10.1021/np070393g