General Information
DRAVP ID DRAVPe00294
Peptide Name Cycloviolacin-Y5 (Plants)
Sequence GIPCAESCVWIPCTVTALVGCSCSDKVCYN
Sequence Length 30
UniProt ID No entry found
Taxon ID None
Source Viola yedoensis (Chinese herb)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay
Activity
Hemolytic Activity
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00294
Linear/Cyclic Cyclic
N-terminal Modification Cyclization (N termini to C termini)
C-terminal Modification Cyclization (N termini to C termini)
Other Modification Disulfide bonds between Cys4 and Cys21; Cys8 and Cys23; Cys13 and Cys28.
Stereochemistry L
Physicochemical Information
Formula C132H209N33O42S6
Absent amino acids FHMQR
Common amino acids C
Mass 3122.67
Pl 4.37
Basic residues 1
Acidic residues 2
Hydrophobic residues 10
Net charge -1
Boman Index 323
Hydrophobicity 79.33
Aliphatic Index 84.33
Half Life
Extinction Coefficient cystines 7365
Absorbance 280nm 253.97
Polar residues 15
Literature Information
Literature 1
Title Cyclotides as natural anti-HIV agents.
Pubmed ID 18008336
Reference Biopolymers. 2008;90(1):51-60.
Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.
Literature 2
Title Anti-HIV cyclotides from the Chinese medicinal herb Viola yedoensis.
Pubmed ID 18081258
Reference J Nat Prod. 2008 Jan;71(1):47-52.
Author Wang CK, Colgrave ML, Gustafson KR, Ireland DC, Goransson U, Craik DJ.