General Information


DRAVP ID  DRAVPe00294

Peptide Name   Cycloviolacin-Y5 (Plants)

Sequence  GIPCAESCVWIPCTVTALVGCSCSDKVCYN

Sequence Length  30

UniProt ID  No entry found

Taxon ID  None

Source  Viola yedoensis (Chinese herb)

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV

Assay 

Activity 

  • [Ref.18618891]Effects: H. contortus( IC50=2.28μM, IC99=22.24μM) and T. colubriformis(IC50=2.40μM, IC99=10.97μM).
  • [Ref.18008336]HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=40 nM).

Hemolytic Activity 

  • [Ref:18081258] HD50=8.7 μM against human type A red blood cells.

Cytotoxicity 

  • [Ref.18008336]CEM-SS cells:IC50=1760 nM.

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00294

Linear/Cyclic  Cyclic

N-terminal Modification  Cyclization (N termini to C termini)

C-terminal Modification  Cyclization (N termini to C termini)

Other Modification  Disulfide bonds between Cys4 and Cys21; Cys8 and Cys23; Cys13 and Cys28.

Stereochemistry  L



Physicochemical Information


Formula  C132H209N33O42S6

Absent amino acids  FHMQR

Common amino acids  C

Mass  3122.67

Pl  4.37

Basic residues  1

Acidic residues  2

Hydrophobic residues  10

Net charge  -1

Boman Index  323

Hydrophobicity  79.33

Aliphatic Index  84.33

Half Life 

  •     Mammalian:30 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  7365

Absorbance 280nm  253.97

Polar residues  15



Literature Information


Literature 1

Title   Cyclotides as natural anti-HIV agents.

Pubmed ID   18008336

Reference   Biopolymers. 2008;90(1):51-60.

Author   Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI   10.1002/bip.20886

Literature 2

Title   Anti-HIV cyclotides from the Chinese medicinal herb Viola yedoensis.

Pubmed ID   18081258

Reference   J Nat Prod. 2008 Jan;71(1):47-52.

Author   Wang CK, Colgrave ML, Gustafson KR, Ireland DC, Goransson U, Craik DJ.

DOI   10.1021/np070393g