To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00295
Peptide Name Leaf cyclotide 1 (Vhl-1; Plant defensin)
Sequence SISCGESCAMISFCFTEVIGCSCKNKVCYLN
Sequence Length 31
UniProt ID P84522
Source Viola hederacea (Australian violet)
Activity Information
Target Organism HIV
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID 1ZA8
Predicted Structure Download DRAVPe00295
Linear/Cyclic Cyclic
N-terminal Modification Cyclization (N termini to C termini)
C-terminal Modification Cyclization (N termini to C termini)
Other Modification Disulfide bonds between Cys4 and Cys21; Cys8 and Cys23; Cys13 and Cys28.
Stereochemistry L
Physicochemical Information
Formula C140H223N35O45S7
Absent amino acids DHPQRW
Common amino acids C
Mass 3340.94
Pl 5.85
Basic residues 2
Acidic residues 2
Hydrophobic residues 9
Net charge 0
Boman Index -1027
Hydrophobicity 69.03
Aliphatic Index 72.26
Half Life
Extinction Coefficient cystines 1865
Absorbance 280nm 62.17
Polar residues 17
Literature Information
Literature 1
Title Cyclotides as natural anti-HIV agents.
Pubmed ID 18008336
Reference Biopolymers. 2008;90(1):51-60.
Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.