General Information


DRAVP ID  DRAVPe00295

Peptide Name   Leaf cyclotide 1 (Vhl-1; Plant defensin)

Sequence  SISCGESCAMISFCFTEVIGCSCKNKVCYLN

Sequence Length  31

UniProt ID  P84522 

Taxon ID  None

Source  Viola hederacea (Australian violet)

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV

Assay 

Activity 

  • [Ref.18008336]HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=870 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  1ZA8 

Predicted Structure Download  DRAVPe00295

Linear/Cyclic  Cyclic

N-terminal Modification  Cyclization (N termini to C termini)

C-terminal Modification  Cyclization (N termini to C termini)

Other Modification  Disulfide bonds between Cys4 and Cys21; Cys8 and Cys23; Cys13 and Cys28.

Stereochemistry  L



Physicochemical Information


Formula  C140H223N35O45S7

Absent amino acids  DHPQRW

Common amino acids  C

Mass  3340.94

Pl  5.85

Basic residues  2

Acidic residues  2

Hydrophobic residues  9

Net charge  0

Boman Index  -1027

Hydrophobicity  69.03

Aliphatic Index  72.26

Half Life 

  •     Mammalian:1.9 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  1865

Absorbance 280nm  62.17

Polar residues  17



Literature Information


Literature 1

Title   Cyclotides as natural anti-HIV agents.

Pubmed ID   18008336

Reference   Biopolymers. 2008;90(1):51-60.

Author   Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI   10.1002/bip.20886