General Information
DRAVP ID DRAVPe00418
Peptide Name MERS-LP
Sequence SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL
Sequence Length 36
UniProt ID No entry found
Source Synthetic construct(derived from HR2 region of MERS-CoV)
Activity Information
Target Organism SARS-CoV-2,SARS-CoV,MERS-CoV,HCoV-NL63
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism A six-helical bundle structure is formed by two heptad repeat domains (HR1 and HR2) in S2, juxtaposing the viral and cellular membranes for fusion.The peptide derived from the HR2 sequence can competitively bind to the viral HR1 domain thus exerting antiviral activity.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00418
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification PEG8-K(Chol)
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C185H307N43O61S
Absent amino acids CFGHPRW
Common amino acids L
Mass 4141.78
Pl 4.18
Basic residues 2
Acidic residues 5
Hydrophobic residues 14
Net charge -3
Boman Index -3327
Hydrophobicity 13.06
Aliphatic Index 138.06
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 85.14
Polar residues 11
Literature Information
Literature 1
Title SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses.
Pubmed ID 34344868
Reference Signal Transduct Target Ther. 2021 Aug 3;6(1):294.
Author Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y.