General Information

General Information

DRAVP ID DRAVPe00418

Peptide Name MERS-LP

Sequence SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL

Sequence Length 36

UniProt ID No entry found

Taxon ID None

Source Synthetic construct(derived from HR2 region of MERS-CoV)

Validation Experimentally Validated

Origin Information

Gene Name/ID Not Available

GenBank Not Available

Amino Acid position Not Available

Domain Accession ID Not Available

Nucleotide sequence ID Not Available

Molecular Type Not Available

Chromosomal Position Not Available

Activity Information

Target Organism SARS-CoV-2,SARS-CoV,MERS-CoV,HCoV-NL63

Assay

Activity

[Ref.34344868]SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=102.9±7.2 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=5046±905.2 nM);
SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=79.1±9.8 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50>25000 nM);
SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50>25000 nM);
MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=82.9±8.6 nM);
HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50>25000 nM);
HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50>25000 nM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity No cytotoxicity information found in the reference(s) presented

Binding Target membrane

Mechanism A six-helical bundle structure is formed by two heptad repeat domains (HR1 and HR2) in S2, juxtaposing the viral and cellular membranes for fusion.The peptide derived from the HR2 sequence can competitively bind to the viral HR1 domain thus exerting antiviral activity.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00418

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification PEG8-K(Chol)

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C185H307N43O61S

Absent amino acids CFGHPRW

Common amino acids L

Mass 4141.78

Pl 4.18

Basic residues 2

Acidic residues 5

Hydrophobic residues 14

Net charge -3

Boman Index -3327

Hydrophobicity 13.06

Aliphatic Index 138.06

Half Life

Mammalian:1.9 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 2980

Absorbance 280nm 85.14

Polar residues 11

Literature Information

Literature 1

Title SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses.

Pubmed ID 34344868

Reference Signal Transduct Target Ther. 2021 Aug 3;6(1):294.

Author Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y.

DOI 10.1038/s41392-021-00698-x