General Information

General Information

DRAVP ID DRAVPe00438

Peptide Name EKL1P

Sequence NVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYGSGK

Sequence Length 40

UniProt ID No entry found

Source Synthetic construct(derived from EK1)

Activity Information

Target Organism SARS-CoV-2

Assay

Activity

[Ref.34367893]SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.182±0.034 μmol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.812±0.182 μmol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.231±0.022 μmol/L),inhibition of cell-cell fusion(IC50=0.064±0.004 μmol/L).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity No cytotoxicity information found in the reference(s) presented

Binding Target membrane

Mechanism The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00438

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Palm

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C214H335N47O70S

Absent amino acids CHPQRW

Common amino acids E

Mass 4718.35

Pl 4.57

Basic residues 6

Acidic residues 10

Hydrophobic residues 11

Net charge -4

Boman Index -7100

Hydrophobicity -72

Aliphatic Index 87.75

Half Life

Mammalian:1.4 hour
Yeast:3 min
E.coli:>10 hour

Extinction Coefficient cystines 5960

Absorbance 280nm 152.82

Polar residues 12

Literature Information

Literature 1

Title A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases.

Pubmed ID 34367893

Reference Acta Pharm Sin B. 2021 Aug 2.

Author Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q.

DOI 10.1016/j.apsb.2021.07.026