General Information
DRAVP ID DRAVPe00441
Peptide Name EKL1C
Sequence NVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYGSGC
Sequence Length 40
UniProt ID No entry found
Taxon ID None
Source Synthetic construct(derived from EK1)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism SARS-CoV-2,SARS-CoV,MERS-CoV,HCoV-NL63,HCoV-OC43
Assay Cell fusion assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00441
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Chol
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C211H328N46O70S2
Absent amino acids HPQRW
Common amino acids E
Mass 4693.31
Pl 4.39
Basic residues 5
Acidic residues 10
Hydrophobic residues 11
Net charge -5
Boman Index -6417
Hydrophobicity -56
Aliphatic Index 87.75
Half Life
Extinction Coefficient cystines 5960
Absorbance 280nm 152.82
Polar residues 13
Literature Information
Literature 1
Title Peptide-based pan-CoV fusion inhibitors maintain high potency against SARS-CoV-2 Omicron variant.
Pubmed ID 35087243
Reference Cell Res. 2022 Apr;32(4):404-406.
Author Xia S, Chan JF, Wang L, Jiao F, Chik KK, Chu H, Lan Q, Xu W, Wang Q, Wang C, Yuen KY, Lu L, Jiang S.
DOI 10.1038/s41422-022-00617-x
Literature 2
Title A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases.
Pubmed ID 34367893
Reference Acta Pharm Sin B. 2021 Aug 2.
Author Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q.