DRAVP ID  DRAVPe00465

Peptide Name   DN59

Sequence  MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY

Sequence Length  33

UniProt ID  No entry found

Taxon ID  11065  

Source  Synthetic construct(derived from the E polyprotein of DENV)

Validation   Experimentally Validated

Gene Name/ID  envelope (E) glycoprotein

GenBank  M29095.1

Amino Acid position  residues 412 to 444

Domain Accession ID  residues 412 to 444 

Nucleotide sequence ID  M29095 

Molecular Type  M29095

Chromosomal Position  Not available

Target Organism  DENV,WNV

Assay 

Activity 

• [Ref.31351847]Dengue virus(DENV): inhibition of DENV infection in LLCKM-2 monkey kidney epithelial cells(IC50~10μM,100.0±0.5% inhibition at 20 μM);
• West Nile virus(WNV): inhibition of WNV infection in LLCKM-2 monkey kidney epithelial cells(>99% inhibition at <25μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• [Ref.31351847]No cytotoxicity against LLCMK-2 monkey kidney epithelial cells at 100 mg/ml.

Binding Target  envelope

Mechanism  The peptide may play roles in protein-protein rearrangements or bilayer membrane interactions during the entry and fusion process and thus inhibit infection of DENV or WNV.

PDB ID  None

Predicted Structure Download  DRAVPe00465

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Peptide derivatives as inhibitors of NS2B-NS3 protease from Dengue, West Nile, and Zika flaviviruses.

Pubmed ID   31351847

Reference   Bioorg Med Chem. 2019 Sep 15;27(18):3963-3978. 

Author   da Silva-Júnior EF, de Araújo-Júnior JX. 

DOI   10.1016/j.bmc.2019.07.038