General Information

General Information

DRAVP ID DRAVPe00465

Peptide Name DN59

Sequence MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY

Sequence Length 33

UniProt ID No entry found

Source Synthetic construct(derived from the E polyprotein of DENV)

Activity Information

Target Organism DENV,WNV

Assay

Activity

[Ref.31351847]Dengue virus(DENV): inhibition of DENV infection in LLCKM-2 monkey kidney epithelial cells(IC50~10μM,100.0±0.5% inhibition at 20 μM);
West Nile virus(WNV): inhibition of WNV infection in LLCKM-2 monkey kidney epithelial cells(>99% inhibition at <25μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.31351847]No cytotoxicity against LLCMK-2 monkey kidney epithelial cells at 100 mg/ml.

Binding Target envelope

Mechanism The peptide may play roles in protein-protein rearrangements or bilayer membrane interactions during the entry and fusion process and thus inhibit infection of DENV or WNV.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00465

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C161H240N38O44S

Absent amino acids CENPR

Common amino acids G

Mass 3443.96

Pl 5.19

Basic residues 2

Acidic residues 2

Hydrophobic residues 16

Net charge 0

Boman Index 1883

Hydrophobicity 77.58

Aliphatic Index 100.61

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 6990

Absorbance 280nm 218.44

Polar residues 11

Literature Information

Literature 1

Title Peptide derivatives as inhibitors of NS2B-NS3 protease from Dengue, West Nile, and Zika flaviviruses.

Pubmed ID 31351847

Reference Bioorg Med Chem. 2019 Sep 15;27(18):3963-3978.

Author da Silva-Júnior EF, de Araújo-Júnior JX.

DOI 10.1016/j.bmc.2019.07.038