General Information


DRAVP ID  DRAVPe00465

Peptide Name   DN59

Sequence  MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY

Sequence Length  33

UniProt ID  No entry found

Taxon ID 

Source  Synthetic construct(derived from the E polyprotein of DENV)

Validation  



Origin Information


Gene Name/ID 

GenBank 

Amino Acid position 

Domain Accession ID 

Nucleotide sequence ID 

Molecular Type 

Chromosomal Position 



Activity Information


Target Organism  DENV,WNV

Assay 

Activity 

  • [Ref.31351847]Dengue virus(DENV): inhibition of DENV infection in LLCKM-2 monkey kidney epithelial cells(IC50~10μM,100.0±0.5% inhibition at 20 μM);
  • West Nile virus(WNV): inhibition of WNV infection in LLCKM-2 monkey kidney epithelial cells(>99% inhibition at <25μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.31351847]No cytotoxicity against LLCMK-2 monkey kidney epithelial cells at 100 mg/ml.

Binding Target  envelope

Mechanism  The peptide may play roles in protein-protein rearrangements or bilayer membrane interactions during the entry and fusion process and thus inhibit infection of DENV or WNV.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00465

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C161H240N38O44S

Absent amino acids  CENPR

Common amino acids  G

Mass  3443.96

Pl  5.19

Basic residues  2

Acidic residues  2

Hydrophobic residues  16

Net charge  0

Boman Index  1883

Hydrophobicity  77.58

Aliphatic Index  100.61

Half Life 

  •     Mammalian:30 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  6990

Absorbance 280nm  218.44

Polar residues  11



Literature Information


Literature 1

Title   Peptide derivatives as inhibitors of NS2B-NS3 protease from Dengue, West Nile, and Zika flaviviruses.

Pubmed ID   31351847

Reference   Bioorg Med Chem. 2019 Sep 15;27(18):3963-3978. 

Author   da Silva-Júnior EF, de Araújo-Júnior JX. 

DOI   10.1016/j.bmc.2019.07.038