General Information


DRAVP ID  DRAVPe00472

Peptide Name   EK1P12HC

Sequence  SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG

Sequence Length  41

UniProt ID  No entry found

Source  Synthetic construct



Activity Information


Target Organism  SARS-CoV-2

Assay  pseudovirus inhibition assay

Activity 

  • [Ref.34769299]SARS-CoV-2:inhibition of Pseudoviruse infection in Caco2 cells(IC50=5.2 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.34769299]no apparent cytotoxicity against Caco-2 cells at concentrations of up to 20 μM.

Binding Target  membrane`

Mechanism  The peptide targets two different sites when mediating virus–cell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  PEG12-25-HC

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C208H336N48O71S

Absent amino acids  CHPRW

Common amino acids  EL

Mass  4677.29

Pl  4.36

Basic residues  5

Acidic residues  10

Hydrophobic residues  13

Net charge  -5

Boman Index  -6701

Hydrophobicity  -44.88

Aliphatic Index  104.63

Half Life 

  •     Mammalian:1.9 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  2980

Absorbance 280nm  74.5

Polar residues  11



Literature Information


Literature 1

Title   25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses.

Pubmed ID   34769299

Reference   Int J Mol Sci. 2021 Nov 1;22(21):11869.

Author   Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S.

DOI   10.3390/ijms222111869