To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00472
Peptide Name EK1P12HC
Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG
Sequence Length 41
UniProt ID No entry found
Source Synthetic construct
Activity Information
Target Organism SARS-CoV-2
Assay pseudovirus inhibition assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane`
Mechanism The peptide targets two different sites when mediating virus–cell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification PEG12-25-HC
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C208H336N48O71S
Absent amino acids CHPRW
Common amino acids EL
Mass 4677.29
Pl 4.36
Basic residues 5
Acidic residues 10
Hydrophobic residues 13
Net charge -5
Boman Index -6701
Hydrophobicity -44.88
Aliphatic Index 104.63
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 74.5
Polar residues 11
Literature Information
Literature 1
Title 25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses.
Pubmed ID 34769299
Reference Int J Mol Sci. 2021 Nov 1;22(21):11869.
Author Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.