General Information


DRAVP ID  DRAVPe00515

Peptide Name   MT-WQ-IDL(626-656)

Sequence  MTWEEWDKKIEEYTKKIEELIKKSQNQQIDL

Sequence Length  31

UniProt ID  P04578 

Source  Synthetic construct



Activity Information


Target Organism  HIV

Assay  ELISA

Activity 

  • [Ref.27795416]HIV-1 IIIB:inhibition of virus infection in MT-2 cells(IC50=0.6±0.1 nM); inhibition of peptide against cell-cell fusion between H9/HIV-1 IIIB cells and MT-2 cells(IC50=1.2± 0.2 nM);
  • HIV-1 Bal:inhibition of virus infection in MT-2 cells(IC50=0.6 ±0.1 nM);
  • HIV-1 clinical isolates(8 clinical isolates):inhibition of virus infection in MT-2 cells(IC50=0.5-15.1 nM);
  • HIV-1 pseudoviruses(7 pseudoviruses):inhibition of pseudoviruses infection in MT-2 cells(IC50=0.1-9.0 nM);
  • HIV-1 T20-resistant strains(5 strains):inhibition of virus infection in MT-2 cells(IC50=0.1-4.4 nM);
  • HIV-1 T2635-resistant strain(6 strains):inhibition of virus infection in MT-2 cells(IC50=1.1-11.3 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  membrane

Mechanism  The peptide inhibits HIV fusion by binding to the hydrophobic grooves on the N-terminal heptad repeat (NHR) trimer and blocking six-helix-bundle (6-HB) formation.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00515

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C176H279N43O56S

Absent amino acids  ACFGHPRV

Common amino acids  EK

Mass  3925.47

Pl  4.86

Basic residues  6

Acidic residues  8

Hydrophobic residues  8

Net charge  -2

Boman Index  -8701

Hydrophobicity  -139.35

Aliphatic Index  75.48

Half Life 

  •     Mammalian:30 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  12490

Absorbance 280nm  416.33

Polar residues  5



Literature Information


Literature 1

Title   Creating an Artificial Tail Anchor as a Novel Strategy To Enhance the Potency of Peptide-Based HIV Fusion Inhibitors.

Pubmed ID   27795416

Reference   J Virol. 2016 Dec 16;91(1):e01445-16.

Author   Su S, Zhu Y, Ye S, Qi Q, Xia S, Ma Z, Yu F, Wang Q, Zhang R, Jiang S, Lu L. 

DOI   10.1128/JVI.01445-16