General Information

General Information

DRAVP ID DRAVPe00515

Peptide Name MT-WQ-IDL(626-656)

Sequence MTWEEWDKKIEEYTKKIEELIKKSQNQQIDL

Sequence Length 31

UniProt ID P04578

Source Synthetic construct

Activity Information

Target Organism HIV

Assay ELISA

Activity

[Ref.27795416]HIV-1 IIIB:inhibition of virus infection in MT-2 cells(IC50=0.6±0.1 nM); inhibition of peptide against cell-cell fusion between H9/HIV-1 IIIB cells and MT-2 cells(IC50=1.2± 0.2 nM);
HIV-1 Bal:inhibition of virus infection in MT-2 cells(IC50=0.6 ±0.1 nM);
HIV-1 clinical isolates(8 clinical isolates):inhibition of virus infection in MT-2 cells(IC50=0.5-15.1 nM);
HIV-1 pseudoviruses(7 pseudoviruses):inhibition of pseudoviruses infection in MT-2 cells(IC50=0.1-9.0 nM);
HIV-1 T20-resistant strains(5 strains):inhibition of virus infection in MT-2 cells(IC50=0.1-4.4 nM);
HIV-1 T2635-resistant strain(6 strains):inhibition of virus infection in MT-2 cells(IC50=1.1-11.3 nM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity No cytotoxicity information found in the reference(s) presented

Binding Target membrane

Mechanism The peptide inhibits HIV fusion by binding to the hydrophobic grooves on the N-terminal heptad repeat (NHR) trimer and blocking six-helix-bundle (6-HB) formation.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00515

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C176H279N43O56S

Absent amino acids ACFGHPRV

Common amino acids EK

Mass 3925.47

Pl 4.86

Basic residues 6

Acidic residues 8

Hydrophobic residues 8

Net charge -2

Boman Index -8701

Hydrophobicity -139.35

Aliphatic Index 75.48

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 12490

Absorbance 280nm 416.33

Polar residues 5

Literature Information

Literature 1

Title Creating an Artificial Tail Anchor as a Novel Strategy To Enhance the Potency of Peptide-Based HIV Fusion Inhibitors.

Pubmed ID 27795416

Reference J Virol. 2016 Dec 16;91(1):e01445-16.

Author Su S, Zhu Y, Ye S, Qi Q, Xia S, Ma Z, Yu F, Wang Q, Zhang R, Jiang S, Lu L.

DOI 10.1128/JVI.01445-16