General Information
DRAVP ID DRAVPe00520
Peptide Name T-20(Enfuvirtide)
Sequence YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Sequence Length 36
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Other Link DRAVPa0326
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay MAGI/cMAGI infectivity assay,neutralization assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00520
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C202H298N50O64
Absent amino acids CGMPRV
Common amino acids EL
Mass 4450.88
Pl 4.3
Basic residues 3
Acidic residues 7
Hydrophobic residues 13
Net charge -4
Boman Index -7259
Hydrophobicity -87.5
Aliphatic Index 89.44
Half Life
Extinction Coefficient cystines 17990
Absorbance 280nm 514
Polar residues 9
Literature Information
Literature 1
Title Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.
Pubmed ID 19073606
Reference J Biol Chem. 2009 Feb 20;284(8):4914-20.
Author Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.
Literature 2
Title Creating an Artificial Tail Anchor as a Novel Strategy To Enhance the Potency of Peptide-Based HIV Fusion Inhibitors.
Pubmed ID 27795416
Reference J Virol. 2016 Dec 16;91(1):e01445-16.
Author Su S, Zhu Y, Ye S, Qi Q, Xia S, Ma Z, Yu F, Wang Q, Zhang R, Jiang S, Lu L.