General Information


DRAVP ID  DRAVPe00520

Peptide Name   T-20(Enfuvirtide)

Sequence  YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

Sequence Length  36

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct

Other Link  DRAVPa0326

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV

Assay  MAGI/cMAGI infectivity assay,neutralization assay

Activity 

  • [Ref.19073606]HIV-1WT:inhibition of virus replication in HeLa cells(EC50=2.4 ± 0.6 nM);
  • HIV-1V38A:inhibition of virus replication in HeLa cells(EC50=23± 8.2 nM);
  • HIV-1N43D:inhibition of virus replication in HeLa cells(EC50=49 ± 10 nM);
  • HIV-1N43D/S138A:inhibition of virus replication in HeLa cells(EC50=84 ± 16 nM).
  • [Ref.27795416]HIV-1 IIIB:inhibition of virus infection in MT-2 cells(IC50=71.8±2.2 nM); inhibition of peptide against cell-cell fusion between H9/HIV-1 IIIB cells and MT-2 cells(IC50=91.0± 1.2 nM);
  • HIV-1 Bal:inhibition of virus infection in MT-2 cells(IC50=70.5 ±0.9 nM);
  • HIV-1 clinical isolates(8 clinical isolates):inhibition of virus infection in MT-2 cells(IC50=20.4-157.3 nM);
  • HIV-1 pseudoviruses(7 pseudoviruses):inhibition of pseudoviruses infection in MT-2 cells(IC50=7.1-91.0 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  membrane

Mechanism  The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00520

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C202H298N50O64

Absent amino acids  CGMPRV

Common amino acids  EL

Mass  4450.88

Pl  4.3

Basic residues  3

Acidic residues  7

Hydrophobic residues  13

Net charge  -4

Boman Index  -7259

Hydrophobicity  -87.5

Aliphatic Index  89.44

Half Life 

  •     Mammalian:2.8 hour
  •     Yeast:10 min
  •     E.coli:2 min

Extinction Coefficient cystines  17990

Absorbance 280nm  514

Polar residues  9



Literature Information


Literature 1

Title   Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.

Pubmed ID   19073606

Reference   J Biol Chem. 2009 Feb 20;284(8):4914-20.

Author   Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.

DOI   10.1074/jbc.M807169200

Literature 2

Title   Creating an Artificial Tail Anchor as a Novel Strategy To Enhance the Potency of Peptide-Based HIV Fusion Inhibitors.

Pubmed ID   27795416

Reference   J Virol. 2016 Dec 16;91(1):e01445-16.

Author   Su S, Zhu Y, Ye S, Qi Q, Xia S, Ma Z, Yu F, Wang Q, Zhang R, Jiang S, Lu L. 

DOI   10.1128/JVI.01445-16