General Information


DRAVP ID  DRAVPe00576

Peptide Name   FP5(FCoV Sgp (1338-1387))

Sequence  FNATYLNLTGEIDDLEFRSEKLHNTTVELAILIDNINNTLVNLEWLNRIE

Sequence Length  50

UniProt ID  P10033 

Taxon ID  None

Source  Synthetic construct(derived from S protein of FCoV)

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  FCoV

Assay  plaque reduction assay

Activity 

  • [Ref.24312629]feline coronavirus(FCoV):inhibition of virus replication in Fcwf-4 cells(IC50=1.33 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.24312629]Fcwf-4 cell:CC50>200 μM.

Binding Target  membrane

Mechanism  The peptide can interfere the fusion of the viral envelope with host membrane and thus inhibits viral replication.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00576

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C261H412N68O84

Absent amino acids  CMPQ

Common amino acids  LN

Mass  5846.55

Pl  4.25

Basic residues  4

Acidic residues  9

Hydrophobic residues  21

Net charge  -5

Boman Index  -8677

Hydrophobicity  -16.4

Aliphatic Index  124.8

Half Life 

  •     Mammalian:1.1 hour
  •     Yeast:3 min
  •     E.coli:2 min

Extinction Coefficient cystines  6990

Absorbance 280nm  142.65

Polar residues  16



Literature Information


Literature 1

Title   Peptides corresponding to the predicted heptad repeat 2 domain of the feline coronavirus spike protein are potent inhibitors of viral infection.

Pubmed ID   24312629

Reference    PLoS One. 2013 Dec 3;8(12):e82081.

Author   Liu IJ, Tsai WT, Hsieh LE, Chueh LL.

DOI   10.1371/journal.pone.0082081