General Information
DRAVP ID DRAVPe00576
Peptide Name FP5(FCoV Sgp (1338-1387))
Sequence FNATYLNLTGEIDDLEFRSEKLHNTTVELAILIDNINNTLVNLEWLNRIE
Sequence Length 50
UniProt ID P10033
Taxon ID None
Source Synthetic construct(derived from S protein of FCoV)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism FCoV
Assay plaque reduction assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide can interfere the fusion of the viral envelope with host membrane and thus inhibits viral replication.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00576
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C261H412N68O84
Absent amino acids CMPQ
Common amino acids LN
Mass 5846.55
Pl 4.25
Basic residues 4
Acidic residues 9
Hydrophobic residues 21
Net charge -5
Boman Index -8677
Hydrophobicity -16.4
Aliphatic Index 124.8
Half Life
Extinction Coefficient cystines 6990
Absorbance 280nm 142.65
Polar residues 16
Literature Information
Literature 1
Title Peptides corresponding to the predicted heptad repeat 2 domain of the feline coronavirus spike protein are potent inhibitors of viral infection.
Pubmed ID 24312629
Reference PLoS One. 2013 Dec 3;8(12):e82081.
Author Liu IJ, Tsai WT, Hsieh LE, Chueh LL.