General Information

General Information

DRAVP ID DRAVPe00598

Peptide Name MT-SC30EK

Sequence MTWEEWDKKIEEYTKKIEELIKKSEEQQKKNE

Sequence Length 32

UniProt ID Q5DP94

Source Synthetic construct

Activity Information

Target Organism HIV

Assay dual split-protein (DSP)-based cell-cell fusion assay,luciferase assay

Activity

[Ref.31277353]HIV-1 NL4-3:inhibition of pseudovirus entry in TZM-bl cells(IC50=0.8±0.1 nM);
HIV-1 HXB2:inhibition of cell-cell fusion in TZM-bl cells(IC50=0.8±0.2 nM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target membrane

Mechanism The peptide inhibits HIV fusion by binding to the hydrophobic grooves on the N-terminal heptad repeat (NHR) trimer and blocking six-helix-bundle (6-HB) formation.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00598

Linear/Cyclic Linear

N-terminal Modification Acetylation

C-terminal Modification Amidation

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C182H289N45O60S

Absent amino acids ACFGHPRV

Common amino acids E

Mass 4099.62

Pl 5.03

Basic residues 8

Acidic residues 10

Hydrophobic residues 6

Net charge -2

Boman Index -11412

Hydrophobicity -196.25

Aliphatic Index 48.75

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 12490

Absorbance 280nm 402.9

Polar residues 5

Literature Information

Literature 1

Title Conserved Residue Asn-145 in the C-Terminal Heptad Repeat Region of HIV-1 gp41 is Critical for Viral Fusion and Regulates the Antiviral Activity of Fusion Inhibitors.

Pubmed ID 31277353

Reference Viruses. 2019 Jul 3;11(7):609.

Author Geng X, Liu Z, Yu D, Qin B, Zhu Y, Cui S, Chong H, He Y.

DOI 10.3390/v11070609