General Information
DRAVP ID DRAVPe00600
Peptide Name MT-SC28EK
Sequence MTWEEWDKKIEEYTKKIEELIKKSEEQQKK
Sequence Length 30
UniProt ID Q5DP94
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism HIV
Assay dual split-protein (DSP)-based cell-cell fusion assay,luciferase assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide inhibits HIV fusion by binding to the hydrophobic grooves on the N-terminal heptad repeat (NHR) trimer and blocking six-helix-bundle (6-HB) formation.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00600
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C173H276N42O55S
Absent amino acids ACFGHNPRV
Common amino acids EK
Mass 3856.4
Pl 5.32
Basic residues 8
Acidic residues 9
Hydrophobic residues 6
Net charge -1
Boman Index -10067
Hydrophobicity -186
Aliphatic Index 52
Half Life
Extinction Coefficient cystines 12490
Absorbance 280nm 430.69
Polar residues 4
Literature Information
Literature 1
Title Conserved Residue Asn-145 in the C-Terminal Heptad Repeat Region of HIV-1 gp41 is Critical for Viral Fusion and Regulates the Antiviral Activity of Fusion Inhibitors.
Pubmed ID 31277353
Reference Viruses. 2019 Jul 3;11(7):609.
Author Geng X, Liu Z, Yu D, Qin B, Zhu Y, Cui S, Chong H, He Y.