General Information

General Information

DRAVP ID DRAVPe00724

Peptide Name T1967(FIV envelope protein (728-760))

Sequence GNITLGEWYNQTKDLQQKFYEIIMDIEQNNVQG

Sequence Length 33

UniProt ID P16090

Source Synthetic construct(derived from FIV envelope protein)

Activity Information

Target Organism FIV,HIV

Assay plaque-forming assay,RT infectivity assay

Activity

[Ref.12186891]Feline immunodeficiency virus (FIV):inhibition of cell-cell fusion between FIV/CrFK cells and HeLa cells(EC50=2.454 μM,EC90>2.518 μM);
HIV-1:inhibition of cell-cell fusion between CEM4/IIIb cells and MOLT4 cells(EC50=2.053 μM,EC90>2.518 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target Not found

Mechanism No machanism information found in the reference(s) presented in this entry

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00724

Linear/Cyclic Linear

N-terminal Modification Acetylation

C-terminal Modification Amidation

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C174H265N45O57S

Absent amino acids ACHPRS

Common amino acids Q

Mass 3931.35

Pl 4.18

Basic residues 2

Acidic residues 5

Hydrophobic residues 9

Net charge -3

Boman Index -6461

Hydrophobicity -86.06

Aliphatic Index 79.7

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 8480

Absorbance 280nm 265

Polar residues 11

Literature Information

Literature 1

Title C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread.

Pubmed ID 12186891

Reference J Virol. 2002 Sep;76(18):9079-86.

Author Medinas RJ, Lambert DM, Tompkins WA.

DOI 10.1128/jvi.76.18.9079-9086.2002