DRAVP ID  DRAVPe00725

Peptide Name   T1968(FIV envelope protein (729-761))

Sequence  NITLGEWYNQTKDLQQKFYEIIMDIEQNNVQGK

Sequence Length  33

UniProt ID  P16090 

Source  Synthetic construct(derived from FIV envelope protein)

Target Organism  FIV,HIV

Assay  plaque-forming assay,RT infectivity assay

Activity 

• [Ref.12186891]Feline immunodeficiency virus (FIV):inhibition of cell-cell fusion between FIV/CrFK cells and HeLa cells(EC50=0.586 μM,EC90=2.067 μM);
• HIV-1:inhibition of cell-cell fusion between CEM4/IIIb cells and MOLT4 cells(EC50>2.473 μM,EC90>2.473 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry

PDB ID  None

Predicted Structure Download  DRAVPe00725

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L

Literature 1

Title   C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread. 

Pubmed ID   12186891

Reference   J Virol. 2002 Sep;76(18):9079-86.

Author   Medinas RJ, Lambert DM, Tompkins WA.

DOI   10.1128/jvi.76.18.9079-9086.2002