DRAVP ID  DRAVPe00726

Peptide Name   T1569(FIV envelope protein (730-764))

Sequence  ITLGEWYNQTKDLQQKFYEIIMDIEQNNVQGKKGI

Sequence Length  35

UniProt ID  P16090 

Taxon ID  None

Source  Synthetic construct(derived from FIV envelope protein)

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not available

Target Organism  FIV,HIV

Assay  plaque-forming assay,RT infectivity assay

Activity 

• [Ref.12186891]Feline immunodeficiency virus (FIV):inhibition of cell-cell fusion between FIV/CrFK cells and HeLa cells(EC50=0.026 μM,EC90=0.117 μM);inhibition of virus infection in FCD4-E cells(EC50=0.055 μM,EC90=0.106 μM);
• HIV-1:inhibition of cell-cell fusion between CEM4/IIIb cells and MOLT4 cells(EC50>2.356 μM,EC90>2.356 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry

PDB ID  None

Predicted Structure Download  DRAVPe00726

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L

Literature 1

Title   C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread. 

Pubmed ID   12186891

Reference   J Virol. 2002 Sep;76(18):9079-86.

Author   Medinas RJ, Lambert DM, Tompkins WA.

DOI   10.1128/jvi.76.18.9079-9086.2002