General Information


DRAVP ID  DRAVPe00729

Peptide Name   T1971(FIV envelope protein (733-767))

Sequence  GEWYNQTKDLQQKFYEIIMDIEQNNVQGKKGIQQL

Sequence Length  35

UniProt ID  P16090 

Taxon ID  None

Source  Synthetic construct(derived from FIV envelope protein)

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  FIV,HIV

Assay  plaque-forming assay,RT infectivity assay

Activity 

  • [Ref.12186891]Feline immunodeficiency virus (FIV):inhibition of cell-cell fusion between FIV/CrFK cells and HeLa cells(EC50=0.012 μM,EC90=0.033 μM);
  • HIV-1:inhibition of cell-cell fusion between CEM4/IIIb cells and MOLT4 cells(EC50>2.342 μM,EC90>2.342 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.12186891]No cytotoxic effects against HeLa cells at the concentration of 23 μM.

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00729

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C188H292N50O59S

Absent amino acids  ACHPRS

Common amino acids  Q

Mass  4228.75

Pl  4.94

Basic residues  4

Acidic residues  5

Hydrophobic residues  9

Net charge  -1

Boman Index  -7758

Hydrophobicity  -111.43

Aliphatic Index  75.14

Half Life 

  •     Mammalian:30 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  8480

Absorbance 280nm  249.41

Polar residues  9



Literature Information


Literature 1

Title   C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread. 

Pubmed ID   12186891

Reference   J Virol. 2002 Sep;76(18):9079-86.

Author   Medinas RJ, Lambert DM, Tompkins WA.

DOI   10.1128/jvi.76.18.9079-9086.2002