General Information


DRAVP ID  DRAVPe00732

Peptide Name   T1588(FIV envelope protein (736-770))

Sequence  YNQTKDLQQKFYEIIMDIEQNNVQGKKGIQQLQKW

Sequence Length  35

UniProt ID  P16090 

Source  Synthetic construct(derived from FIV envelope protein)



Activity Information


Target Organism  FIV

Assay  plaque-forming assay,RT infectivity assay

Activity 

  • [Ref.12186891]Feline immunodeficiency virus (FIV):inhibition of cell-cell fusion between FIV/CrFK cells and HeLa cells(EC50=0.030 μM,EC90=0.125 μM);inhibition of virus infection in FCD4-E cells(EC50=0.168 μM,EC90=0.4236 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00732

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C192H302N52O58S

Absent amino acids  ACHPRS

Common amino acids  Q

Mass  4298.88

Pl  8.3

Basic residues  5

Acidic residues  4

Hydrophobic residues  9

Net charge  1

Boman Index  -8280

Hydrophobicity  -121.43

Aliphatic Index  75.14

Half Life 

  •     Mammalian:2.8 hour
  •     Yeast:10 min
  •     E.coli:2 min

Extinction Coefficient cystines  8480

Absorbance 280nm  249.41

Polar residues  8



Literature Information


Literature 1

Title   C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread. 

Pubmed ID   12186891

Reference   J Virol. 2002 Sep;76(18):9079-86.

Author   Medinas RJ, Lambert DM, Tompkins WA.

DOI   10.1128/jvi.76.18.9079-9086.2002