To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00812
Peptide Name IQN17
Sequence RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Sequence Length 45
UniProt ID No entry found
Source Synthetic construct
Other Link DRAVPa0204
Activity Information
Target Organism HIV
Assay HIV luciferase assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide inhibits HIV-1 entry by inhibiting the fusion between virus and cell membrane.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00812
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C243H423N69O68S
Absent amino acids CFHPY
Common amino acids IK
Mass 5431.51
Pl 9.78
Basic residues 11
Acidic residues 7
Hydrophobic residues 17
Net charge 4
Boman Index -10181
Hydrophobicity -62.89
Aliphatic Index 123.56
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 125
Polar residues 4
Literature Information
Literature 1
Title Design of potent inhibitors of HIV-1 entry from the gp41 N-peptide region.
Pubmed ID 11572974
Reference Proc Natl Acad Sci U S A. 2001 Sep 25;98(20):11187-92.
Author Eckert DM, Kim PS.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.