DRAVP ID  DRAVPe00813

Peptide Name   IQN17[G572D]

Sequence  RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWDIKQLQARIL

Sequence Length  45

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  HIV

Assay  HIV luciferase assay

Activity 

• [Ref.11572974]HIV-1:inhibition of cell-cell fusion between 293T cells and HOS-CD4/fusion cells(IC50=15±5 µM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  membrane

Mechanism  The peptide inhibits HIV-1 entry by inhibiting the fusion between virus and cell membrane.

PDB ID  None

Predicted Structure Download  DRAVPe00813

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L

Literature 1

Title   Design of potent inhibitors of HIV-1 entry from the gp41 N-peptide region.

Pubmed ID   11572974

Reference   Proc Natl Acad Sci U S A. 2001 Sep 25;98(20):11187-92.

Author   Eckert DM, Kim PS.

DOI   10.1073/pnas.201392898