General Information


DRAVP ID  DRAVPe00833

Peptide Name   HP23-E6-IDL

Sequence  EMTWEEWEKKIEEYTKKIEEILKKSQNQQIDL

Sequence Length  32

UniProt ID  No entry found 

Source  Synthetic construct



Activity Information


Target Organism  HIV

Assay  HIV-1-Mediated Cell-Cell Fusion Assay

Activity 

  • [Ref.30901967]HIV-1IIIB(X4 virus):inhibition of virus infection in MT-2 cells(IC50=338 pM);inhibition of cell-cell fusion between H9/IIIB cells and MT-2 cells(IC50=1.14 nM);
  • HIV-1Bal(R5 virus):inhibition of virus infection in MT-2 cells(IC50=813 pM);
  • HIV-1 NL4-3 D36G(6 T-20 resistant strains, WT,V38A,V38A/N42D,V38E/N42S,V38A/N42T,N42T/N43K):inhibition of virus infection in MT-2 cells(IC50=748-1543 pM);
  • HIV-1 LAI (7 T2635-Resistant Strains,WT,A6V,Q66R,K90E,K154Q,Q79E/N126K,K90E/N126K):inhibition of virus infection in MT-2 cells(IC50=349-1423 pM);
  • HIV-1 NL4-3 (5 HP23-Resistant Strains,WT,E49K,E49K/N126K,D36G/E49K/N126K,L34S/D36G/E49K/E136G):inhibition of virus infection in MT-2 cells(IC50=699-4937 pM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.30901967]No cytotoxicity against MT-2 or M7 cells at the concentrations as high as 8 μM.

Binding Target  membrane

Mechanism  It was a fusion inhibitor and inhibits cell-cell fusion



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00833

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C182H288N44O59S

Absent amino acids  ACFGHPRV

Common amino acids  E

Mass  4068.61

Pl  4.73

Basic residues  6

Acidic residues  9

Hydrophobic residues  8

Net charge  -3

Boman Index  -9191

Hydrophobicity  -145.94

Aliphatic Index  73.13

Half Life 

  •     Mammalian:1 hour
  •     Yeast:30 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  12490

Absorbance 280nm  402.9

Polar residues  5



Literature Information


Literature 1

Title   A Peptide-Based HIV-1 Fusion Inhibitor with Two Tail-Anchors and Palmitic Acid Exhibits Substantially Improved In Vitro and Ex Vivo Anti-HIV-1 Activity and Prolonged In Vivo Half-Life.

Pubmed ID   30901967

Reference   Molecules. 2019 Mar 21;24(6):1134.

Author   Su S, Rasquinha G, Du L, Wang Q, Xu W, Li W, Lu L, Jiang S.

DOI   10.3390/molecules24061134