General Information

General Information

DRAVP ID DRAVPe00835

Peptide Name YIK-C16(625-656)

Sequence EMTWEEWEKKIEEYIKKIEEILKKSQNQQIDLGSGX

Sequence Length 36

UniProt ID No entry found

Taxon ID None

Source Synthetic construct

Validation Experimentally Validated

Origin Information

Gene Name/ID Not Available

GenBank Not Available

Amino Acid position Not Available

Domain Accession ID Not Available

Nucleotide sequence ID Not Available

Molecular Type Not Available

Chromosomal Position Not Available

Activity Information

Target Organism HIV

Assay HIV-1-Mediated Cell-Cell Fusion Assay

Activity

[Ref.30901967]HIV-1IIIB(X4 virus):inhibition of virus infection in MT-2 cells(IC50=76 pM);inhibition of cell-cell fusion between H9/IIIB cells and MT-2 cells(IC50=0.55 nM);
HIV-1Bal(R5 virus):inhibition of virus infection in MT-2 cells(IC50=61 pM);
HIV-1 NL4-3 D36G(6 T-20 resistant strains, WT,V38A,V38A/N42D,V38E/N42S,V38A/N42T,N42T/N43K):inhibition of virus infection in MT-2 cells(IC50=40-179 pM);
HIV-1 LAI (7 T2635-Resistant Strains,WT,A6V,Q66R,K90E,K154Q,Q79E/N126K,K90E/N126K):inhibition of virus infection in MT-2 cells(IC50=65-106 pM);
HIV-1 NL4-3 (5 HP23-Resistant Strains,WT,E49K,E49K/N126K,D36G/E49K/N126K,L34S/D36G/E49K/E136G):inhibition of virus infection in MT-2 cells(IC50=65-188 pM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.30901967]No cytotoxicity against MT-2 or M7 cells at the concentrations as high as 8 μM.

Binding Target membrane

Mechanism It was a fusion inhibitor and inhibits cell-cell fusion

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification The 'X' at position 36 indicates PEG4-Lys-C16(Palmitic Acid).

Stereochemistry L

Physicochemical Information

Formula C191H301N47O61S

Absent amino acids ACFHPRV

Common amino acids E

Mass 4393.18

Pl 4.73

Basic residues 6

Acidic residues 9

Hydrophobic residues 9

Net charge -3

Boman Index -8594

Hydrophobicity -119.72

Aliphatic Index 75.83

Half Life

Mammalian:1 hour
Yeast:30 min
E.coli:>10 hour

Extinction Coefficient cystines 12490

Absorbance 280nm 356.86

Polar residues 7

Literature Information

Literature 1

Title A Peptide-Based HIV-1 Fusion Inhibitor with Two Tail-Anchors and Palmitic Acid Exhibits Substantially Improved In Vitro and Ex Vivo Anti-HIV-1 Activity and Prolonged In Vivo Half-Life.

Pubmed ID 30901967

Reference Molecules. 2019 Mar 21;24(6):1134.

Author Su S, Rasquinha G, Du L, Wang Q, Xu W, Li W, Lu L, Jiang S.

DOI 10.3390/molecules24061134