General Information


DRAVP ID  DRAVPe00897

Peptide Name   T-104

Sequence  IINFYDPLVFPSDEFDASISQVNEKINQSLAFIRK

Sequence Length  35

UniProt ID  P69353 

Taxon ID  None

Source  Synthetic construct(derived from Respiratory syncytial virus(RSV) fusion (F) protein)

Other Link  DRAVPa1211

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  RSV

Assay  Cytopathic effect(CPE) assay

Activity 

  • [Ref.8700906]Respiratory syncytial virus(RSV):protection of HEp2cell from viral cytopathic effect(CPE)(EC50=91 μg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.8700906]No significant cytotoxic against HEp2 cells(CC50>100 μM).

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00897

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C187H285N45O56

Absent amino acids  CGHMTW

Common amino acids  I

Mass  4059.59

Pl  4.44

Basic residues  3

Acidic residues  5

Hydrophobic residues  15

Net charge  -2

Boman Index  -5248

Hydrophobicity  -4.86

Aliphatic Index  100.29

Half Life 

  •     Mammalian:20 hour
  •     Yeast:30 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  1490

Absorbance 280nm  43.82

Polar residues  8



Literature Information


Literature 1

Title   Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion. 

Pubmed ID   8700906

Reference   Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.

Author   Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.

DOI   10.1073/pnas.93.5.2186