General Information


DRAVP ID  DRAVPe00898

Peptide Name   T-105

Sequence  INFYDPLVFPSDEFDASISQVNEKINQSLAFIRKS

Sequence Length  35

UniProt ID  P69353 

Source  Synthetic construct(derived from Respiratory syncytial virus(RSV) fusion (F) protein)

Other Link  DRAVPa1212



Activity Information


Target Organism  RSV

Assay  Cytopathic effect(CPE) assay

Activity 

  • [Ref.8700906]Respiratory syncytial virus(RSV):protection of HEp2 cell from viral cytopathic effect(CPE)(EC50=93 μg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.8700906]No significant cytotoxic against HEp2 cells(CC50>100 μM).

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00898

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C184H279N45O57

Absent amino acids  CGHMTW

Common amino acids  S

Mass  4033.51

Pl  4.44

Basic residues  3

Acidic residues  5

Hydrophobic residues  14

Net charge  -2

Boman Index  -6080

Hydrophobicity  -20

Aliphatic Index  89.14

Half Life 

  •     Mammalian:20 hour
  •     Yeast:30 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  1490

Absorbance 280nm  43.82

Polar residues  9



Literature Information


Literature 1

Title   Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion. 

Pubmed ID   8700906

Reference   Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.

Author   Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.

DOI   10.1073/pnas.93.5.2186