General Information
DRAVP ID DRAVPe00903
Peptide Name T-110
Sequence PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLH
Sequence Length 35
UniProt ID P69353
Taxon ID None
Source Synthetic construct(derived from Respiratory syncytial virus(RSV) fusion (F) protein)
Other Link DRAVPa1216
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism RSV
Assay Cytopathic effect(CPE) assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00903
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C179H280N46O57
Absent amino acids CGMTWY
Common amino acids S
Mass 3988.47
Pl 4.58
Basic residues 4
Acidic residues 6
Hydrophobic residues 14
Net charge -2
Boman Index -6355
Hydrophobicity -24.57
Aliphatic Index 100.29
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 7
Literature Information
Literature 1
Title Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion.
Pubmed ID 8700906
Reference Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.
Author Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.