General Information


DRAVP ID  DRAVPe00907

Peptide Name   T-114

Sequence  PSDEFDASISQVNEKINQSLAFIRKSDELLHNVNA

Sequence Length  35

UniProt ID  P69353 

Source  Synthetic construct(derived from Respiratory syncytial virus(RSV) fusion (F) protein)

Other Link  DRAVPa1220



Activity Information


Target Organism  RSV

Assay  Cytopathic effect(CPE) assay

Activity 

  • [Ref.8700906]Respiratory syncytial virus(RSV):protection of HEp2 cell from viral cytopathic effect(CPE)(EC50=6 μg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.8700906]No significant cytotoxic against HEp2 cells(CC50>100 μM).

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00907

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C170H270N48O59

Absent amino acids  CGMTWY

Common amino acids  S

Mass  3930.3

Pl  4.58

Basic residues  4

Acidic residues  6

Hydrophobic residues  13

Net charge  -2

Boman Index  -8292

Hydrophobicity  -53.71

Aliphatic Index  92

Half Life 

  •     Mammalian:>20 hour
  •     Yeast:>20 hour
  •     E.coli:?

Extinction Coefficient cystines  0

Absorbance 280nm  0

Polar residues  9



Literature Information


Literature 1

Title   Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion. 

Pubmed ID   8700906

Reference   Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.

Author   Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.

DOI   10.1073/pnas.93.5.2186