General Information


DRAVP ID  DRAVPe00920

Peptide Name   T-196

Sequence  LNNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ

Sequence Length  35

UniProt ID  P69353 

Source  Synthetic construct(derived from Human parainfluenza virus type 3(HPIV-3) fusion (F) protein)

Other Link  DRAVPa0359



Activity Information


Target Organism  HPIV-3

Assay  Cytopathic effect(CPE) assay

Activity 

  • [Ref.8700906]Human parainfluenza virus type 3(HPIV-3):protection of HEp2 cell from viral cytopathic effect(CPE)(EC50=1 μg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.8700906]No significant cytotoxic against HEp2 cells(CC50>100 μM).

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00920

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C173H286N50O60

Absent amino acids  CFGHMTY

Common amino acids  S

Mass  4026.47

Pl  4.72

Basic residues  5

Acidic residues  7

Hydrophobic residues  12

Net charge  -2

Boman Index  -9964

Hydrophobicity  -80.57

Aliphatic Index  103.14

Half Life 

  •     Mammalian:5.5 hour
  •     Yeast:3 min
  •     E.coli:2 min

Extinction Coefficient cystines  5500

Absorbance 280nm  161.76

Polar residues  9



Literature Information


Literature 1

Title   Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion. 

Pubmed ID   8700906

Reference   Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.

Author   Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.

DOI   10.1073/pnas.93.5.2186