To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00921
Peptide Name T-197
Sequence NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
Sequence Length 35
UniProt ID P69353
Source Synthetic construct(derived from Human parainfluenza virus type 3(HPIV-3) fusion (F) protein)
Other Link DRAVPa0360
Activity Information
Target Organism HPIV-3
Assay Cytopathic effect(CPE) assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00921
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C173H287N51O60
Absent amino acids CFGHMTY
Common amino acids S
Mass 4041.49
Pl 5.1
Basic residues 6
Acidic residues 7
Hydrophobic residues 11
Net charge -1
Boman Index -11011
Hydrophobicity -102.57
Aliphatic Index 92
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 161.76
Polar residues 9
Literature Information
Literature 1
Title Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion.
Pubmed ID 8700906
Reference Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.
Author Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.