DRAVP ID  DRAVPe00921

Peptide Name   T-197

Sequence  NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQK

Sequence Length  35

UniProt ID  P69353 

Taxon ID  None

Source  Synthetic construct(derived from Human parainfluenza virus type 3(HPIV-3) fusion (F) protein)

Other Link  DRAVPa0360

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  HPIV-3

Assay  Cytopathic effect(CPE) assay

Activity 

• [Ref.8700906]Human parainfluenza virus type 3(HPIV-3):protection of HEp2 cell from viral cytopathic effect(CPE)(EC50=6 μg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• [Ref.8700906]No significant cytotoxic against HEp2 cells(CC50>100 μM).

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry

PDB ID  None

Predicted Structure Download  DRAVPe00921

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L

Literature 1

Title   Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion. 

Pubmed ID   8700906

Reference   Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.

Author   Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.

DOI   10.1073/pnas.93.5.2186