General Information


DRAVP ID  DRAVPe00922

Peptide Name   T-198

Sequence  NSVALDPIDISIELNKAKSDLEESKEWIRRSNQKL

Sequence Length  35

UniProt ID  P69353 

Source  Synthetic construct(derived from Human parainfluenza virus type 3(HPIV-3) fusion (F) protein)

Other Link  DRAVPa0361



Activity Information


Target Organism  HPIV-3

Assay  Cytopathic effect(CPE) assay

Activity 

  • [Ref.8700906]Human parainfluenza virus type 3(HPIV-3):protection of HEp2 cell from viral cytopathic effect(CPE)(EC50=0.2 μg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.8700906]No significant cytotoxic against HEp2 cells(CC50>100 μM).

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00922

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C175H292N50O59

Absent amino acids  CFGHMTY

Common amino acids  S

Mass  4040.54

Pl  5.1

Basic residues  6

Acidic residues  7

Hydrophobic residues  12

Net charge  -1

Boman Index  -9855

Hydrophobicity  -81.71

Aliphatic Index  103.14

Half Life 

  •     Mammalian:1.4 hour
  •     Yeast:3 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  5500

Absorbance 280nm  161.76

Polar residues  8



Literature Information


Literature 1

Title   Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion. 

Pubmed ID   8700906

Reference   Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.

Author   Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.

DOI   10.1073/pnas.93.5.2186