To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00937
Peptide Name T-253
Sequence DAVYLHRIDLGPPISLERLDVGTNLQNAIAKLEDA
Sequence Length 35
UniProt ID P69353
Taxon ID None
Source Synthetic construct(derived from measles virus(MV) fusion (F) protein)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism MeV
Assay Cytopathic effect(CPE) assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00937
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C169H277N47O54
Absent amino acids CFMW
Common amino acids L
Mass 3831.34
Pl 4.52
Basic residues 4
Acidic residues 6
Hydrophobic residues 15
Net charge -2
Boman Index -5200
Hydrophobicity -7.14
Aliphatic Index 128.29
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 43.82
Polar residues 7
Literature Information
Literature 1
Title Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion.
Pubmed ID 8700906
Reference Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.
Author Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.