General Information


DRAVP ID  DRAVPe00939

Peptide Name   T-255

Sequence  VYLHRIDLGPPISLERLDVGTNLQNAIAKLEDAKE

Sequence Length  35

UniProt ID  P69353 

Source  Synthetic construct(derived from measles virus(MV) fusion (F) protein)



Activity Information


Target Organism  MeV

Assay  Cytopathic effect(CPE) assay

Activity 

  • [Ref.8700906]measles virus(MV):protection of HEp2 cell from viral cytopathic effect(CPE)(EC50=85.3 μg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.8700906]No significant cytotoxic against HEp2 cells(CC50>100 μM).

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00939

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C173H286N48O54

Absent amino acids  CFMW

Common amino acids  L

Mass  3902.46

Pl  4.95

Basic residues  5

Acidic residues  6

Hydrophobic residues  14

Net charge  -1

Boman Index  -5745

Hydrophobicity  -23.43

Aliphatic Index  125.43

Half Life 

  •     Mammalian:100 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  1490

Absorbance 280nm  43.82

Polar residues  7



Literature Information


Literature 1

Title   Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion. 

Pubmed ID   8700906

Reference   Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.

Author   Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.

DOI   10.1073/pnas.93.5.2186