General Information


DRAVP ID  DRAVPe01292

Peptide Name   sHR2-1(derived from SARS-CoV spike protein heptad repeat)

Sequence  ELDSPKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYE

Sequence Length  64

UniProt ID  P59594 

Source  Synthetic construct(derived from SARS-CoV spike protein heptad repeat)



Activity Information


Target Organism  SARS-CoV

Assay  Indirect immunofluorescence assay

Activity 

  • [Ref.15150417]SARS-CoV:inhibition of virus infection in Vero cells(EC50=43 ± 6.4 μM);
  • murine coronavirus:inhibition of virus infection in Vero cells(EC50>50 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  membrane

Mechanism  The peptide exhibits antiviral activity by competitive binding to the HR1 region of the SARS-CoV spike protein, thus blocking the formation of the six-helix bundle and consequently membrane fusion.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe01292

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C316H507N83O111

Absent amino acids  CMW

Common amino acids  ELD

Mass  7244.99

Pl  4.34

Basic residues  8

Acidic residues  15

Hydrophobic residues  20

Net charge  -7

Boman Index  -14963

Hydrophobicity  -73.75

Aliphatic Index  100.47

Half Life 

  •     Mammalian:1 hour
  •     Yeast:30 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  2980

Absorbance 280nm  47.3

Polar residues  17



Literature Information


Literature 1

Title   Severe acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.

Pubmed ID   15150417

Reference   Proc Natl Acad Sci U S A. 2004 Jun 1;101(22):8455-60.

Author   Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.

DOI   10.1073/pnas.0400576101