General Information
DRAVP ID DRAVPe01339
Peptide Name mEP-2
Sequence CEEIRARLSTHLRKMRKRLMRDADDLQKRLAVY
Sequence Length 33
UniProt ID P02649
Source Synthetic construct(derived from human apolipoprotein E)
Activity Information
Target Organism HCV
Assay RT PCR
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not found
Mechanism hEP peptide blocks the binding of virus to cells, suggesting a role of apoE at the very early stage of HCV entry.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01339
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C172H300N60O48S3
Absent amino acids FGNPW
Common amino acids R
Mass 4072.83
Pl 10.4
Basic residues 11
Acidic residues 5
Hydrophobic residues 10
Net charge 6
Boman Index -13221
Hydrophobicity -93.33
Aliphatic Index 88.79
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 46.56
Polar residues 4
Literature Information
Literature 1
Title Human apolipoprotein E peptides inhibit hepatitis C virus entry by blocking virus binding.
Pubmed ID 22334503
Reference Hepatology. 2012 Aug;56(2):484-91.
Author Liu S, McCormick KD, Zhao W, Zhao T, Fan D, Wang T.