General Information


DRAVP ID  DRAVPe01340

Peptide Name   hEP-3

Sequence  CEEQAQQIRLQAEAFQARLKSWFEPLVEDM

Sequence Length  30

UniProt ID  P02649 

Source  Synthetic construct(derived from human apolipoprotein E)



Activity Information


Target Organism  HCV

Assay  RT PCR

Activity 

  • [Ref.22334503]hepatitis C virus(HCVpp):inhibition of infection in Huh7.5.1 cells(IC50>10 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  Not found

Mechanism  hEP peptide blocks the binding of virus to cells, suggesting a role of apoE at the very early stage of HCV entry.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe01340

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C158H245N43O49S2

Absent amino acids  GHNTY

Common amino acids  EQ

Mass  3595.06

Pl  4.42

Basic residues  3

Acidic residues  6

Hydrophobic residues  12

Net charge  -3

Boman Index  -6638

Hydrophobicity  -58

Aliphatic Index  75

Half Life 

  •     Mammalian:1.2 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  5500

Absorbance 280nm  189.66

Polar residues  2



Literature Information


Literature 1

Title   Human apolipoprotein E peptides inhibit hepatitis C virus entry by blocking virus binding.

Pubmed ID   22334503

Reference   Hepatology. 2012 Aug;56(2):484-91.

Author   Liu S, McCormick KD, Zhao W, Zhao T, Fan D, Wang T.

DOI   10.1002/hep.25665