General Information


DRAVP ID  DRAVPe01435

Peptide Name   G154-189(derived from RSV attachment glycoprotein)

Sequence  KPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRI

Sequence Length  36

UniProt ID  P03423 

Source  Synthetic construct(derived from RSV attachment glycoprotein)



Activity Information


Target Organism  RSV

Assay  NMR

Activity 

  • [Ref.11487583]Respiratory syncytial virus(RSV):inhibition of the cytopathic effect of RSV in HEp-2 cells(IC50=12 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe01435

Linear/Cyclic  Cyclic

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  The peptide formed two disulfide bonds.

Stereochemistry  L



Physicochemical Information


Formula  C187H278N50O50S4

Absent amino acids  GLMQY

Common amino acids  NP

Mass  4154.81

Pl  8.52

Basic residues  5

Acidic residues  2

Hydrophobic residues  11

Net charge  3

Boman Index  -5371

Hydrophobicity  -30.56

Aliphatic Index  51.39

Half Life 

  •     Mammalian:1.3 hour
  •     Yeast:3 min
  •     E.coli:2 min

Extinction Coefficient cystines  5750

Absorbance 280nm  164.29

Polar residues  13



Literature Information


Literature 1

Title   Antiviral activity and structural characteristics of the nonglycosylated central subdomain of human respiratory syncytial virus attachment (G) glycoprotein.

Pubmed ID   11487583

Reference   J Biol Chem. 2001 Oct 19;276(42):38988-94.

Author   Gorman JJ, McKimm-Breschkin JL, Norton RS, Barnham KJ. 

DOI   10.1074/jbc.M106288200