To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01521
Peptide Name E6apc2
Sequence YKFACPECPKRFMRSDHLSKHITLHELLGEERR
Sequence Length 33
UniProt ID No entry found
Source Synthetic construct(derived from E6-associated protein (E6AP))
Activity Information
Target Organism HPV
Assay CD spectroscopy
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target E6 protein
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01521
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C177H280N54O48S3
Absent amino acids NQVW
Common amino acids ELR
Mass 4028.68
Pl 8.82
Basic residues 10
Acidic residues 5
Hydrophobic residues 8
Net charge 5
Boman Index -9756
Hydrophobicity -90.91
Aliphatic Index 62.12
Half Life
Extinction Coefficient cystines 1615
Absorbance 280nm 50.47
Polar residues 7
Literature Information
Literature 1
Title Design and characterization of helical peptides that inhibit the E6 protein of papillomavirus.
Pubmed ID 15182185
Reference Biochemistry. 2004 Jun 15;43(23):7421-31.
Author Liu Y, Liu Z, Androphy E, Chen J, Baleja JD.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.