General Information
DRAVP ID DRAVPe01521
Peptide Name E6apc2
Sequence YKFACPECPKRFMRSDHLSKHITLHELLGEERR
Sequence Length 33
UniProt ID No entry found
Taxon ID None
Source Synthetic construct(derived from E6-associated protein (E6AP))
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HPV
Assay CD spectroscopy
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target E6 protein
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01521
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C177H280N54O48S3
Absent amino acids NQVW
Common amino acids ELR
Mass 4028.68
Pl 8.82
Basic residues 10
Acidic residues 5
Hydrophobic residues 8
Net charge 5
Boman Index -9756
Hydrophobicity -90.91
Aliphatic Index 62.12
Half Life
Extinction Coefficient cystines 1615
Absorbance 280nm 50.47
Polar residues 7
Literature Information
Literature 1
Title Design and characterization of helical peptides that inhibit the E6 protein of papillomavirus.
Pubmed ID 15182185
Reference Biochemistry. 2004 Jun 15;43(23):7421-31.
Author Liu Y, Liu Z, Androphy E, Chen J, Baleja JD.