General Information
DRAVP ID DRAVPe01739
Peptide Name SARS-CoV-S (1134-1189)
Sequence LDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYE
Sequence Length 56
UniProt ID P59594
Source Synthetic construct
Activity Information
Target Organism SARS-CoV, MHV
Assay Infection inhibition assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism Inhibits virus infection by interfering with six-helix bundle formation(fusion inhibitor).
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C277H446N74O94
Absent amino acids CMW
Common amino acids LDN
Mass 6317.03
Pl 4.5
Basic residues 7
Acidic residues 11
Hydrophobic residues 19
Net charge -4
Boman Index -11645
Hydrophobicity -54.82
Aliphatic Index 107.86
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 54.18
Polar residues 16
Literature Information
Literature 1
Title Severe acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.
Pubmed ID 15150417
Reference Proc Natl Acad Sci U S A. 2004 Jun 1;101(22):8455-60.
Author Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.