General Information


DRAVP ID  DRAVPe01741

Peptide Name   SARS-CoV-S (1134-1193)

Sequence  ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK

Sequence Length  68

UniProt ID  P59594 

Source  Synthetic construct



Activity Information


Target Organism  SARS-CoV, MHV

Assay  Infection inhibition assay

Activity 

  • [Ref.15150417]SARS-CoV: inhibition of SARS-CoV infection in Vero 118 cells (EC50=17±3.0µM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  membrane

Mechanism  Inhibits virus infection by interfering with six-helix bundle formation(fusion inhibitor).



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C346H549N89O117

Absent amino acids  CMW

Common amino acids  ELDK

Mass  7827.69

Pl  4.46

Basic residues  9

Acidic residues  15

Hydrophobic residues  22

Net charge  -6

Boman Index  -15296

Hydrophobicity  -69.12

Aliphatic Index  100.29

Half Life 

  •     Mammalian:1 hour
  •     Yeast:30 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  4470

Absorbance 280nm  66.72

Polar residues  18



Literature Information


Literature 1

Title   Severe acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.

Pubmed ID   15150417

Reference   Proc Natl Acad Sci U S A. 2004 Jun 1;101(22):8455-60.

Author   Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.

DOI   10.1073/pnas.0400576101