To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02022
Peptide Name CRAMP-1
Sequence GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
Sequence Length 33
UniProt ID P51437
Taxon ID 10090
Source Mus musculus(Mouse)
Validation Experimentally Validated
Origin Information
Gene Name/ID CAMP(12796)
GenBank U43409.1
Amino Acid position 135-172
Domain Accession ID pfam12153
Nucleotide sequence ID CM001002.3
Molecular Type mRNA
Chromosomal Position Chromosome 9,(125-172)
Activity Information
Target Organism HRV,AV
Assay Not Available
Activity No activity information or data found in the reference(s) presented in this entry
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not Available
Mechanism Not Available
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C173H294N48O44
Absent amino acids ADCHMSTWYOU
Common amino acids K
Mass 3750.53
Pl 10.22
Basic residues 9
Acidic residues 3
Hydrophobic residues 12
Net charge 6
Boman Index 1.0286
Hydrophobicity -0.815
Aliphatic Index 91.52
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 16
Literature Information
Literature 1
Title Human Cathelicidin (LL-37), a Multifunctional Peptide, is Expressed by Ocular Surface Epithelia and has Potent Antibacterial and Antiviral Activity
Pubmed ID 16020269
Reference Current eye research, 30(5), 385–394
Author Gordon, Y. J., Huang, L. C., Romanowski, E. G., Yates, K. A., Proske, R. J., & McDermott, A. M. (2005)
Literature 2
Title Cathelicidin antimicrobial peptides suppress EV71 infection via regulating antiviral response and inhibiting viral binding
Pubmed ID 33508330
Reference Antiviral research, 187, 105021.
Author Yu, J., Dai, Y., Fu, Y., Wang, K., Yang, Y., Li, M., Xu, W., & Wei, L. (2021)
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.