To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02023
Peptide Name CRAMP-2
Sequence ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
Sequence Length 38
UniProt ID P51437
Taxon ID 10090
Source Natural Construct (obtained from Mouse cathelicidin)
Validation Experimentally Validated
Origin Information
Gene Name/ID CAMP(12796)
GenBank U43409.1
Amino Acid position 135-172
Domain Accession ID pfam12153
Nucleotide sequence ID CM001002.3
Molecular Type mRNA
Chromosomal Position Chromosome 9,(125-172)
Activity Information
Target Organism EV71
Assay Hemagglutination inhibition assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Membrane
Mechanism CRAMP significantly inhibited EV71 replication, suggesting that CRAMP possibly enhanced the antiviral immune response of host cells.CRAMP did not directly inactivate EV71 virons, but effectively regulated IFN-β and IL-6 response and markedly inhibited viral binding.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C197H338N56O50
Absent amino acids DCHMTWYOU
Common amino acids K
Mass 4291.2
Pl 10.46
Basic residues 10
Acidic residues 3
Hydrophobic residues 12
Net charge 7
Boman Index 1.59
Hydrophobicity -0.582
Aliphatic Index 102.63
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 18
Literature Information
Literature 1
Title Cathelicidin antimicrobial peptides suppress EV71 infection via regulating antiviral response and inhibiting viral binding
Pubmed ID 33508330
Reference Antiviral research, 187, 105021.
Author Yu, J., Dai, Y., Fu, Y., Wang, K., Yang, Y., Li, M., Xu, W., & Wei, L. (2021)
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.