To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe02028
Peptide Name PL8
Sequence PSSKRFQPFQQFGRDVSDFTDSVRDPKTSE
Sequence Length 30
Taxon ID 694009
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID S2 (918758)
GenBank KC881005
Amino Acid position N/A
Domain Accession ID cd22378
Nucleotide sequence ID KC881005
Molecular Type Genomic RNA
Chromosomal Position N/A
Activity Information
Target Organism SARS-CoV
Assay Syncytia inhibition assay
Activity Not Avaialble
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Spike Protein
Mechanism P8 antisera had specific binding to the S fragments and S protein expressed in E. coli and SARS‐CoV infected cell lysates, suggesting that those Abs have a potential to recognize S protein of SARS‐CoV in its natural form
Structure Information
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C152H230N44O51
Absent amino acids ACHILMNWY
Common amino acids DFSPQR
Mass 3489.76
Pl 6.1
Basic residues 5
Acidic residues 5
Hydrophobic residues
Net charge 0
Boman Index
Hydrophobicity -1.343
Aliphatic Index 19.33
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 0
Literature Information
Literature 1
Title Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential
Pubmed ID 15811330
Reference FEBS letters, 579(10), 2130–2136.
Author Xia, S., Liu, M., Wang, C., Xu, W., Lan, Q., Feng, S., Qi, F., Bao, L., Du, L., Liu, S., Qin, C., Sun, F., Shi, Z., Zhu, Y., Jiang, S., & Lu, L. (2020)
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.