DRAVP ID  DRAVPe02066

Peptide Name   Av-LCTX-An1a

Sequence  GFGCPLDQMQCHNHCQSVRYRGGYCTNFLKMTCKCY

Sequence Length  36

UniProt ID  A0A5Q1NCA8 

Taxon ID  2664917 

Source  venom gland of the A. nagpag spider

Validation   Experimentally Validated

Gene Name/ID  Not Found

GenBank  QGD15041.1

Amino Acid position  25-60

Domain Accession ID  NF038042 pfam01097 

Nucleotide sequence ID  MN319466 

Molecular Type  mRNA

Chromosomal Position  Not Available

Target Organism  DENV-2,ZIKV

Assay  protease inhibition assay

Activity 

• [Ref:31658707]Dengue virus-2 (DENV2): An1a showed ~10 µM 50% inhibition in Vero cells.Zika virus (ZIKV):An1a showed ~2 µM 50% inhibition in Vero cells. It acts as a competitive inhibitor of ZIKV NS2B–NS3 protease (Ki = 12.54 ± 1.88 µM). Inhibited replication in HUVEC and A549 cells.DENV2 and ZIKV NS2B–NS3 protease: Ki = 9.47 µM for DENV2; Ki = 12.54 µM for ZIKV.

Hemolytic Activity 

• [Ref:31658707]hemolytic: no hemolysis of hRBC below 20 uM

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  Protease

Mechanism  An1a suppresses DENV2 replication and infectious virus production.Also An1a may inhibit DENV2 replication and particle production by interacting with the NS2B–NS3 protease.

PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  Gly4–Ser–Gly4 linker,

Stereochemistry  L

Literature 1

Title   An Antiviral Peptide from Alopecosa nagpag Spider Targets NS2B-NS3 Protease of Flaviviruses

Pubmed ID   31658707

Reference   Toxins, 11(10), 584. 

Author   Ji, M., Zhu, T., Xing, M., Luan, N., Mwangi, J., Yan, X., Mo, G., Rong, M., Li, B., Lai, R., & Jin, L. (2019).

DOI   10.3390/toxins11100584